Expired Domains List - Daily Drops Updated 06:00 UTC
Daily expired-domain drops across .org / .info / .dev / .blog and more. Free, no signup.
| Domain ↕ | Registered ↕ | Status | Drops ▲ | Wayback ↕ | Registrar | |
|---|---|---|---|---|---|---|
| waimaotong163.xyz | 2025-04-01 | Pending delete | 2026-04-01 | 0 | Alibaba Cloud | |
| waitingforthefuture.info | 2024-05-10 | 2026-06-16 | 2027-05-10 | 0 | Tucows | |
| wakehomevalues.info | 2016-03-30 | 2026-06-16 | 2026-03-30 | 0 | Go Daddy | |
| walcon.xyz | 2026-05-08 | 2026-06-16 | 2027-05-08 | 0 | PublicDomainRegistry | |
| walfozastudio.xyz | 2026-04-23 | 2026-06-16 | 2027-04-23 | 0 | CV Jogjacamp | |
| walkingonthesun.blog | 2024-03-31 | Pending delete | 2026-03-31 | 0 | Tucows | |
| walkroundtheworld.blog | 2025-03-29 | Pending delete | 2026-03-29 | 0 | Hostinger | |
| wallet-coinbase.info | 2025-04-08 | 2026-06-16 | 2026-04-08 | 0 | Register SPA | |
| wallet-firelight.xyz | 2026-05-07 | 2026-06-16 | 2027-05-07 | 0 | Dynadot | |
| walletdownloads.xyz | 2026-05-06 | 2026-06-16 | 2027-05-06 | 0 | NameSilo | |
| walletidentities.xyz | 2025-03-30 | Pending delete | 2026-03-30 | 0 | Go Daddy | |
| wallets-firelight.xyz | 2026-05-06 | 2026-06-16 | 2027-05-06 | 0 | Dynadot | |
| wallets-flare.xyz | 2026-05-06 | 2026-06-16 | 2027-05-06 | 0 | Dynadot | |
| wallinside.blog | 2023-03-24 | Pending delete | 2027-03-24 | 0 | Sav.com, LLC - 23 | |
| walrus-launch.xyz | 2025-03-31 | Pending delete | 2026-03-31 | 0 | Dynadot | |
| walson.xyz | 2025-04-01 | Pending delete | 2026-04-01 | 0 | Alibaba Cloud | |
| wancativi.blog | 2026-02-18 | Pending delete | 2027-02-18 | 0 | Automattic | |
| wangshengran.xyz | 2025-04-02 | Pending delete | 2026-04-02 | 0 | Alibaba Cloud | |
| wangshuangyan1.xyz | 2025-04-01 | Pending delete | 2026-04-01 | 0 | Alibaba Cloud | |
| wanke28701gf.xyz | 2025-04-02 | Pending delete | 2026-04-02 | 0 | Alibaba Cloud | |
| wanren.xyz | 2025-04-01 | Pending delete | 2026-04-01 | 0 | Alibaba Cloud | |
| waori-japan.site | 2024-03-29 | Pending delete | 2026-03-29 | 0 | Onamae | |
| wapnxy.info | 2025-03-30 | 2026-06-16 | 2026-03-30 | 0 | Namecheap | |
| wardivorce.blog | 2025-03-30 | Pending delete | 2026-03-30 | 0 | Go Daddy | |
| warfaredivorce.blog | 2025-03-30 | Pending delete | 2026-03-30 | 0 | Go Daddy | |
| warfaredivorces.blog | 2025-03-30 | Pending delete | 2026-03-30 | 0 | Go Daddy | |
| warfareindivorce.blog | 2025-03-30 | Pending delete | 2026-03-30 | 0 | Go Daddy | |
| warfareindivorces.blog | 2025-03-30 | Pending delete | 2026-03-30 | 0 | Go Daddy | |
| warmuptosolar.info | 2017-03-30 | 2026-06-16 | 2026-03-30 | 0 | Go Daddy | |
| warriorrz-chaoss.site | 2025-03-30 | Pending delete | 2026-03-30 | 0 | Namecheap | |
| warriorsgym.store | 2025-04-05 | Pending delete | 2026-04-05 | 0 | Namify | |
| warsaw-shledrc-acak.info | 2025-04-01 | 2026-06-16 | 2026-04-01 | 0 | NameSilo | |
| warsewaworld.store | 2025-04-05 | Pending delete | 2026-04-05 | 0 | Namify | |
| warsztat.xyz | 2025-05-12 | 2026-06-16 | 2027-05-12 | 0 | NETIM | |
| wartezeit.app | 2025-03-31 | Pending delete | 2026-03-31 | 0 | Tucows | |
| warungbet88.info | 2024-04-02 | 2026-06-16 | 2026-04-02 | 0 | NameSilo | |
| warungqq99.info | 2024-04-02 | 2026-06-16 | 2026-04-02 | 0 | NameSilo | |
| wasenderstore.site | 2025-03-29 | Pending delete | 2026-03-29 | 0 | Hostinger | |
| wasz-st.xyz | 2025-03-30 | Pending delete | 2026-03-30 | 0 | Go Daddy | |
| watchpulse.store | 2025-04-01 | Pending delete | 2026-04-01 | 0 | Beget | |
| watchtobynbk.store | 2026-05-10 | 2026-06-16 | 2027-05-10 | 0 | Spaceship | |
| waterproofwala.xyz | 2025-03-28 | Pending delete | 2026-03-28 | 0 | Hostinger | |
| watervb2023x6.xyz | 2025-04-01 | Pending delete | 2026-04-01 | 0 | Alibaba Cloud | |
| watkins-houseware.store | 2025-03-30 | Pending delete | 2026-03-30 | 0 | Go Daddy | |
| watsbot.xyz | 2026-05-06 | 2026-06-16 | 2027-05-06 | 0 | Ultahost | |
| watsdat.xyz | 2024-03-30 | Pending delete | 2026-03-30 | 0 | Namecheap | |
| watzemeta.xyz | 2026-05-10 | 2026-06-16 | 2027-05-10 | 0 | Tucows | |
| waveenergyai.xyz | 2026-05-05 | 2026-06-16 | 2027-05-05 | 0 | Atak Domain | |
| wavepoweredai.xyz | 2026-05-05 | 2026-06-16 | 2027-05-05 | 0 | Atak Domain | |
| wavex.site | 2025-03-29 | Pending delete | 2026-03-29 | 0 | Hostinger | |
| wayfind.blog | 2018-03-28 | Pending delete | 2026-03-28 | 0 | 1API | |
| waystopeace.xyz | 2025-03-29 | Pending delete | 2026-03-29 | 0 | Hostinger | |
| wayvitravels.blog | 2025-03-29 | Pending delete | 2026-03-29 | 0 | Hostinger | |
| wazakea.online | 2026-04-27 | 2026-06-16 | 2027-04-27 | 0 | Onamae | |
| wb-account.site | 2026-05-08 | 2026-06-16 | 2027-05-08 | 0 | Global Domain Group | |
| wb-login.online | 2026-05-09 | 2026-06-16 | 2027-05-09 | 0 | Global Domain Group | |
| wb-tvoy-priz.site | 2025-04-01 | Pending delete | 2026-04-01 | 0 | Beget | |
| wbanews.info | 2013-05-09 | 2026-06-16 | 2027-05-09 | 0 | DreamHost | |
| wbase.xyz | 2021-04-01 | Pending delete | 2026-04-01 | 0 | REG.RU | |
| wbeuxd.info | 2025-03-30 | 2026-06-16 | 2026-03-30 | 0 | Namecheap | |
| wbkenwoodsplycorner.online | 2025-03-30 | Pending delete | 2026-03-30 | 0 | Go Daddy | |
| wbsmart.store | 2025-04-02 | Pending delete | 2026-04-02 | 0 | REG.RU | |
| wbzgtp.info | 2025-03-30 | 2026-06-16 | 2026-03-30 | 0 | Namecheap | |
| wd10.xyz | 2024-05-11 | 2026-06-16 | 2027-05-11 | 0 | Gandi | |
| wd985a.xyz | 2025-03-31 | Pending delete | 2026-03-31 | 0 | Dynadot | |
| wdbos28.info | 2024-04-02 | 2026-06-16 | 2026-04-02 | 0 | NameSilo | |
| wdslot88.info | 2024-04-02 | 2026-06-16 | 2026-04-02 | 0 | NameSilo | |
| wdwbkh.info | 2025-03-30 | 2026-06-16 | 2026-03-30 | 0 | Namecheap | |
| wdwebrobotics.online | 2025-03-29 | Pending delete | 2026-03-29 | 0 | Hostinger | |
| we-2c.info | 2024-03-30 | 2026-06-16 | 2026-03-30 | 0 | Go Daddy | |
| we-exposed.info | 2025-03-29 | 2026-06-16 | 2026-03-29 | 0 | IONOS SE | |
| we2c.info | 2024-03-30 | 2026-06-16 | 2026-03-30 | 0 | Go Daddy | |
| we2ce.info | 2024-03-30 | 2026-06-16 | 2026-03-30 | 0 | Go Daddy | |
| we2cs.info | 2024-03-30 | 2026-06-16 | 2026-03-30 | 0 | Go Daddy | |
| weakling.app | 2025-03-30 | Pending delete | 2026-03-30 | 0 | Namecheap | |
| wealth-ai.info | 2025-03-30 | 2026-06-16 | 2026-03-30 | 0 | Namecheap | |
| wealthai.info | 2025-03-30 | 2026-06-16 | 2026-03-30 | 0 | Namecheap | |
| wealthcounselnobleglobalevolve.xyz | 2025-03-30 | Pending delete | 2026-03-30 | 0 | Namecheap | |
| wealthfusion.store | 2025-03-30 | Pending delete | 2026-03-30 | 0 | Go Daddy | |
| wealthfusion.xyz | 2025-03-30 | Pending delete | 2026-03-30 | 0 | Go Daddy | |
| wealthgraphsecuresupportcreate.xyz | 2025-03-30 | Pending delete | 2026-03-30 | 0 | Namecheap | |
| wealthlinkselectbridgeexpand.xyz | 2025-03-30 | Pending delete | 2026-03-30 | 0 | Namecheap | |
| wealthmanageprimeentrysysvital.xyz | 2025-03-30 | Pending delete | 2026-03-30 | 0 | Namecheap | |
| wealthmastery.xyz | 2025-03-27 | Pending delete | 2026-03-27 | 0 | West.cn | |
| wealthmeasureservicechainsteer.xyz | 2025-03-30 | Pending delete | 2026-03-30 | 0 | Namecheap | |
| wealthnetbridgeallianceguide.xyz | 2025-03-30 | Pending delete | 2026-03-30 | 0 | Namecheap | |
| wealthoriginnodechoiceadapt.xyz | 2025-03-30 | Pending delete | 2026-03-30 | 0 | Namecheap | |
| wealthquantumextendaccesscoach.xyz | 2025-03-30 | Pending delete | 2026-03-30 | 0 | Namecheap | |
| wealthtrust.online | 2025-05-11 | 2026-06-16 | 2027-05-11 | 0 | Atak Domain | |
| wearealreadygreat2029.info | 2025-03-30 | 2026-06-16 | 2026-03-30 | 0 | Go Daddy | |
| wearealreadygreat2029.xyz | 2025-03-30 | Pending delete | 2026-03-30 | 0 | Go Daddy | |
| wearethewo.site | 2025-05-11 | 2026-06-16 | 2027-05-11 | 0 | Dreamscape Networks | |
| weasciotrio.tech | 2026-05-07 | 2026-06-16 | 2027-05-07 | 0 | Namify | |
| weashoufoub.tech | 2026-05-07 | 2026-06-16 | 2027-05-07 | 0 | Namify | |
| weatherskads.xyz | 2026-05-06 | 2026-06-16 | 2027-05-06 | 0 | Spaceship | |
| weaver25.tech | 2026-05-07 | 2026-06-16 | 2027-05-07 | 0 | Namify | |
| web-finance.site | 2025-05-03 | 2026-06-16 | 2027-05-03 | 0 | Hosting Ukraine | |
| web-siteofficial.site | 2025-03-29 | Pending delete | 2026-03-29 | 0 | Hostinger | |
| web-tanuki.site | 2023-03-28 | Pending delete | 2026-03-28 | 0 | XServer | |
| web-willows.store | 2025-04-05 | Pending delete | 2026-04-05 | 0 | Namify |
About this list
DomainReborn tracks domains as they leave the official ICANN zone files (CZDS) and walks each one through the lifecycle: expiring -> dropped -> redemption (grace) -> pending delete -> available. New drops are imported daily after 06:00 UTC and enriched with WHOIS data plus a Wayback Machine archive count so you can spot domains with real history. Use the filters above to narrow by status (Dropping / Expiring / Available) or TLD. Click any column header to sort. Everything is free - we are funded only by registrar affiliate links on each domain page.
Frequently Asked Questions
How often is the list updated?
Daily. CZDS zone files publish at 00:00 UTC and we ingest all approved TLDs between 06:00 and 07:30 UTC. WHOIS and Wayback enrichment runs throughout the day.
What does 'pending delete' mean?
After a domain expires, ICANN gives the original owner ~30 days of redemption to renew. After that, the registry locks the domain for ~5 days (pending delete). Once that window ends, the domain is publicly released and anyone can register it.
When can I actually buy a dropped domain?
When its status flips to Available. Domains marked Dropping or Pending delete are still locked - you can only register them once the registry releases them. Each domain page shows the exact public release date.
Is the data really free?
Yes. No signup, no paywall, no API key. We make a small commission only when you click a registrar link (Namecheap / GoDaddy / Hostinger) on a domain page and register through it.
Do you have .com data?
Not yet - .com requires Verisign zone access (separate approval from generic CZDS). We currently track .org, .info, .dev, .app, .blog, .store, .tech, .site, .online, .xyz.
How do I get notified when a specific domain becomes available?
Sign in with Google and click + Watch on any domain page (or in the table). We email you the moment the registry releases it. Manage subscriptions at /watchlist. Free, no quotas.